PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.14G089300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family Dof
Protein Properties Length: 331aa    MW: 35824.4 Da    PI: 8.0316
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.14G089300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.91.1e-383089261
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  Manes.14G089300.1.p 30 NHQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRS 89
                         57899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-282888IPR003851Zinc finger, Dof-type
PfamPF027013.0E-333288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6183488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MQDIHSIGGG GRLFNGGGGD RRLRPHHHQN HQALKCPRCD SLNTKFCYYN NYNLSQPRHF  60
CKSCRRYWTK GGVLRNVPVG GGCRKTKRSK PKQATSTADP TTSSTNTATA TISTTQSPEQ  120
QQQQQRDRKS SNSHSSSESS SLTATNTTGA NTGLEAISAH SSGSASNNIL NGISESKLFA  180
HANINPNFES GLLEQGADCG IFSEIGTLTS LITSTNEQLP IGFGNIMNQK CVEHVQQNQN  240
QQWQQQQQKM VGISGEEMKM QDMAGGLIDQ TVHVELSALQ SSRTGNGGFG ALDWPGTGDQ  300
GLFDLPNAVD QTYWSQSQWT DQGSPSLYLP *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1917GGRLFNGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012080436.11e-136PREDICTED: dof zinc finger protein DOF5.4
TrEMBLA0A067KGJ91e-136A0A067KGJ9_JATCU; Uncharacterized protein
STRINGPOPTR_0012s12670.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.18e-39OBF binding protein 4